Lineage for d4l6sb2 (4l6s B:797-1011)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1681419Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1681420Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1681691Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 1681692Protein automated matches [191197] (6 species)
    not a true protein
  7. 1681724Species Human (Homo sapiens) [TaxId:9606] [225406] (21 PDB entries)
  8. 1681731Domain d4l6sb2: 4l6s B:797-1011 [224572]
    Other proteins in same PDB: d4l6sa1, d4l6sb1
    automated match to d1gs0a2
    protein/DNA complex; complexed with 1wq

Details for d4l6sb2

PDB Entry: 4l6s (more details), 2.2 Å

PDB Description: parp complexed with benzo[1,4]oxazin-3-one inhibitor
PDB Compounds: (B:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4l6sb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l6sb2 d.166.1.0 (B:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

SCOPe Domain Coordinates for d4l6sb2:

Click to download the PDB-style file with coordinates for d4l6sb2.
(The format of our PDB-style files is described here.)

Timeline for d4l6sb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4l6sb1