Lineage for d4kvda_ (4kvd A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2731436Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2731437Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2731747Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 proteins)
  6. 2731778Protein automated matches [190618] (1 species)
    not a true protein
  7. 2731779Species Aspergillus terreus [TaxId:33178] [187650] (16 PDB entries)
  8. 2731804Domain d4kvda_: 4kvd A: [224486]
    automated match to d2oa6d_
    complexed with 1ss, gol, mg, pop

Details for d4kvda_

PDB Entry: 4kvd (more details), 2.4 Å

PDB Description: Crystal structure of Aspergillus terreus aristolochene synthase complexed with (4aS,7S)-1,4a-dimethyl-7-(prop-1-en-2-yl)decahydroquinolin-1-ium
PDB Compounds: (A:) Aristolochene synthase

SCOPe Domain Sequences for d4kvda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kvda_ a.128.1.4 (A:) automated matches {Aspergillus terreus [TaxId: 33178]}
lepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkald
drihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlwe
smrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvgkellaalmrfsmg
lklspselqrvreidancskhlsvvndiysyekelytsktahseggilctsvqilaqead
vtaeaakrvlfvmcrewelrhqllvarlsaegletpglaayvegleyqmsgnelwsqttl
rysv

SCOPe Domain Coordinates for d4kvda_:

Click to download the PDB-style file with coordinates for d4kvda_.
(The format of our PDB-style files is described here.)

Timeline for d4kvda_: