Class a: All alpha proteins [46456] (290 folds) |
Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
Family a.128.1.4: Aristolochene/pentalenene synthase [48586] (3 proteins) |
Protein automated matches [190618] (1 species) not a true protein |
Species Aspergillus terreus [TaxId:33178] [187650] (16 PDB entries) |
Domain d4kvda_: 4kvd A: [224486] automated match to d2oa6d_ complexed with 1ss, gol, mg, pop |
PDB Entry: 4kvd (more details), 2.4 Å
SCOPe Domain Sequences for d4kvda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kvda_ a.128.1.4 (A:) automated matches {Aspergillus terreus [TaxId: 33178]} lepppstfqplchplveevskevdgyflqhwnfpnekarkkfvaagfsrvtclyfpkald drihfacrlltvlfliddlleymsfeegsayneklipisrgdvlpdrsipveyiiydlwe smrahdremadeilepvflfmraqtdrtrarpmglggyleyrerdvgkellaalmrfsmg lklspselqrvreidancskhlsvvndiysyekelytsktahseggilctsvqilaqead vtaeaakrvlfvmcrewelrhqllvarlsaegletpglaayvegleyqmsgnelwsqttl rysv
Timeline for d4kvda_: