SCOPe 2.07: Domain d4kemb2: 4kem B:142-390

Lineage for d4kemb2 (4kem B:142-390)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (78 species)
   not a true protein

7. Species Azospirillum sp. [TaxId:137722] [226671] (1 PDB entry)

8. Domain d4kemb2: 4kem B:142-390 [224272]
   Other proteins in same PDB: d4kema1, d4kemb1
   automated match to d1tzza1
   complexed with akr, cl, mg

Details for d4kemb2

PDB Entry: 4kem, 1.3 Å

PDB Description: Crystal structure of a tartrate dehydratase from azospirillum, target efi-502395, with bound mg and a putative acrylate ion, ordered active site

PDB Compounds: (B:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d4kemb2:

Sequence; same for both SEQRES and ATOM records:

>d4kemb2 c.1.11.0 (B:142-390) automated matches {Azospirillum sp. [TaxId: 137722]}
vaddgvwvyaaggyyypgkdvkalqdemrsyrdrgyrvvkmkiggaplaedlrridavle
vvgsgdnlcvdangrfdidtaiaygealkpyglfwyeeagdpldyalqaelakhydrpma
tgenlfshqdarnlirhggmrpdrdwlqfdcalsyglveylrtldmlkengwssrrvvph
gghqmslniaaglhlggnesypdvfkpfcgfadgiavedgrvrlpdlpgvgfeakselfa
tmsgllgtr

Timeline for d4kemb2:

• d4kemb2 first appeared in SCOPe 2.03
  
• d4kemb2 appears in SCOPe 2.06
  
• d4kemb2 appears in the current release, SCOPe 2.08