Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (94 species) not a true protein |
Species Azospirillum sp. [TaxId:137722] [226670] (1 PDB entry) |
Domain d4kemb1: 4kem B:1-141 [224271] Other proteins in same PDB: d4kema2, d4kemb2 automated match to d1tzza2 complexed with akr, cl, mg |
PDB Entry: 4kem (more details), 1.3 Å
SCOPe Domain Sequences for d4kemb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kemb1 d.54.1.0 (B:1-141) automated matches {Azospirillum sp. [TaxId: 137722]} mriveireqtagiksdianafidfsqmtcsvvavvtdvvrdgkpvigygfnsngryaagg llrerfiprlmsaapdslldetgenldpfriwtrlmtnekpgghgersvavgtidmavwd avakiagvplyrlladrfrgg
Timeline for d4kemb1: