Lineage for d4jaxc1 (4jax C:11-223)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1373353Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1373354Protein automated matches [226839] (35 species)
    not a true protein
  7. 1373511Species Kluyveromyces lactis [TaxId:284590] [226650] (1 PDB entry)
  8. 1373516Domain d4jaxc1: 4jax C:11-223 [223664]
    automated match to d1ig8a1
    complexed with gol, po4

Details for d4jaxc1

PDB Entry: 4jax (more details), 2.26 Å

PDB Description: crystal structure of dimeric klhxk1 in crystal form x
PDB Compounds: (C:) hexokinase

SCOPe Domain Sequences for d4jaxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jaxc1 c.55.1.0 (C:11-223) automated matches {Kluyveromyces lactis [TaxId: 284590]}
arkgsmadvpanlmeqihgletlftvssekmrsivkhfiseldkglskkggnipmipgwv
veyptgketgdflaldlggtnlrvvlvklggnhdfdttqnkyrlpdhlrtgtseqlwsfi
akclkefvdewypdgvseplplgftfsypasqkkinsgvlqrwtkgfdiegveghdvvpm
lqeqieklnipinvvalindttgtlvaslytdp

SCOPe Domain Coordinates for d4jaxc1:

Click to download the PDB-style file with coordinates for d4jaxc1.
(The format of our PDB-style files is described here.)

Timeline for d4jaxc1: