Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (35 species) not a true protein |
Species Kluyveromyces lactis [TaxId:284590] [226650] (1 PDB entry) |
Domain d4jaxb2: 4jax B:224-484 [223663] automated match to d1ig8a2 complexed with gol, po4 |
PDB Entry: 4jax (more details), 2.26 Å
SCOPe Domain Sequences for d4jaxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jaxb2 c.55.1.0 (B:224-484) automated matches {Kluyveromyces lactis [TaxId: 284590]} qtkmgiiigtgvngayydvvsgieklegllpedigpdspmainceygsfdnehlvlprtk ydviideesprpgqqafekmtsgyylgeimrlvlldlydsgfifkdqdisklkeayvmdt sypskieddpfenledtddlfktnlniettvverklirklaelvgtraarltvcgvsaic dkrgyktahiaadgsvfnrypgykekaaqalkdiynwdvekmedhpiqlvaaedgsgvga aiiacltqkrlaagksvgikg
Timeline for d4jaxb2: