SCOPe 2.03: Domain d4j6pb_: 4j6p B:

Lineage for d4j6pb_ (4j6p B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Low affinity immunoglobulin epsilon Fc receptor [143957] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143958] (10 PDB entries)
   Uniprot P06734 156-298

8. Domain d4j6pb_: 4j6p B: [223592]
   automated match to d1t8ca1

Details for d4j6pb_

PDB Entry: 4j6p, 1.9 Å

PDB Description: Crystal structure of calcium2+-free wild-type CD23 lectin domain (crystal form F)

PDB Compounds: (B:) Low affinity immunoglobulin epsilon Fc receptor

SCOPe Domain Sequences for d4j6pb_:

Sequence, based on SEQRES records:

>d4j6pb_ d.169.1.1 (B:) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]}
fvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhasht
gswiglrnldlkgefiwvdgshvdysnwapgeptsrsqgedcvmmrgsgrwndafcdrkl
gawvcdrlatctp

Sequence, based on observed residues (ATOM records):

>d4j6pb_ d.169.1.1 (B:) Low affinity immunoglobulin epsilon Fc receptor {Human (Homo sapiens) [TaxId: 9606]}
fvcntcpekwinfqrkcyyfgkgtkqwvharyacddmegqlvsihspeeqdfltkhasht
gswiglrnldlkgefiwvdgshvdysnwapgeptqgedcvmmrgsgrwndafcdrklgaw
vcdrlatctp

Timeline for d4j6pb_:

• d4j6pb_ is new in SCOPe 2.03-stable
  
• d4j6pb_ appears in SCOPe 2.04
  
• d4j6pb_ appears in the current release, SCOPe 2.08