Lineage for d4iwkf_ (4iwk F:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1727565Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1728392Protein Non-hem ferritin [63524] (6 species)
  7. 1728411Species Pseudo-nitzschia multiseries [TaxId:37319] [188675] (9 PDB entries)
  8. 1728417Domain d4iwkf_: 4iwk F: [223453]
    automated match to d3e6sa_
    complexed with fe

Details for d4iwkf_

PDB Entry: 4iwk (more details), 1.65 Å

PDB Description: crystal structure of iron soaked (overnight) ferritin from pseudo- nitzschia multiseries
PDB Compounds: (F:) Ferritin

SCOPe Domain Sequences for d4iwkf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iwkf_ a.25.1.1 (F:) Non-hem ferritin {Pseudo-nitzschia multiseries [TaxId: 37319]}
seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
npfhlqqvneedkigsilakvtdenrtpgllrsldvvsf

SCOPe Domain Coordinates for d4iwkf_:

Click to download the PDB-style file with coordinates for d4iwkf_.
(The format of our PDB-style files is described here.)

Timeline for d4iwkf_: