Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.11: PapD-like [49354] (3 families) contains PP switch between strands D and C' |
Family b.1.11.2: MSP-like [49360] (4 proteins) Pfam PF00635 |
Protein Major sperm protein, MSP [49361] (2 species) |
Species Pig roundworm (Ascaris suum), alpha isoform [TaxId:6253] [49362] (4 PDB entries) |
Domain d3mspa_: 3msp A: [22343] |
PDB Entry: 3msp (more details)
SCOPe Domain Sequences for d3mspa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mspa_ b.1.11.2 (A:) Major sperm protein, MSP {Pig roundworm (Ascaris suum), alpha isoform [TaxId: 6253]} aqsvppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcg vldpkekvlmavscdtfnaatedlnndritiewtntpdgaakqfrrewfqgdgmvrrknl pieynl
Timeline for d3mspa_: