SCOP 1.63: Domain d2msph_: 2msp H:

Lineage for d2msph_ (2msp H:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (2 families)
   contains PP switch between strands D and C'

5. Family b.1.11.2: Major sperm protein [49360] (1 protein)

6. Protein Major sperm protein [49361] (2 species)

7. Species Pig roundworm (Ascaris suum), alpha isoform [TaxId:6253] [49362] (3 PDB entries)

8. Domain d2msph_: 2msp H: [22342]
   mutant

Details for d2msph_

PDB Entry: 2msp, 3.3 Å

PDB Description: major sperm protein, beta isoform, engineered c59s/t90c mutant, putative subfilament structure, ph 8.5

SCOP Domain Sequences for d2msph_:

Sequence; same for both SEQRES and ATOM records:

>d2msph_ b.1.11.2 (H:) Major sperm protein {Pig roundworm (Ascaris suum), alpha isoform}
svppgdintqpgskivfnapyddkhtyhikitnaggrrigwaikttnmrrlgvdppsgvl
dpsekvlmavscdtfnaatedlnndriciewtntpdgaakqfrrewfqgdgmvrrknlpi
eynl

Timeline for d2msph_:

• d2msph_ first appeared (with stable ids) in SCOP 1.55
  
• d2msph_ appears in SCOP 1.61
  
• d2msph_ appears in SCOP 1.65
  
• d2msph_ appears in the current release, SCOPe 2.08