SCOPe 2.07: Domain d4iuoa1: 4iuo A:1-251

Lineage for d4iuoa1 (4iuo A:1-251)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (91 species)
   not a true protein

7. Species Salmonella enterica [TaxId:99287] [226761] (5 PDB entries)

8. Domain d4iuoa1: 4iuo A:1-251 [223393]
   Other proteins in same PDB: d4iuoa2, d4iuob2
   automated match to d4h3dd_
   complexed with qic; mutant

Details for d4iuoa1

PDB Entry: 4iuo, 1.8 Å

PDB Description: 1.8 angstrom crystal structure of the salmonella enterica 3- dehydroquinate dehydratase (arod) k170m mutant in complex with quinate

PDB Compounds: (A:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4iuoa1:

Sequence; same for both SEQRES and ATOM records:

>d4iuoa1 c.1.10.0 (A:1-251) automated matches {Salmonella enterica [TaxId: 99287]}
mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaes
vleaagaireiitdkpllftfrsakeggeqalttgqyidlnraavdsglvdmidlelftg
ddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipmiavmpqtkad
vltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkkasapgqisva
dlrtvltilhq

Timeline for d4iuoa1:

• d4iuoa1 first appeared in SCOPe 2.03, called d4iuoa_
  
• d4iuoa1 appears in SCOPe 2.06
  
• d4iuoa1 appears in the current release, SCOPe 2.08