SCOPe 2.05: Domain d4iqfb1: 4iqf B:-1-204

Lineage for d4iqfb1 (4iqf B:-1-204)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.65: Formyltransferase [53327] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest

4. Superfamily c.65.1: Formyltransferase [53328] (2 families)

5. Family c.65.1.0: automated matches [191608] (1 protein)
   not a true family

6. Protein automated matches [191110] (9 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [226570] (1 PDB entry)

8. Domain d4iqfb1: 4iqf B:-1-204 [223314]
   Other proteins in same PDB: d4iqfa2, d4iqfb2, d4iqfc2, d4iqfd2
   automated match to d1fmta2
   complexed with gol, pg5, so4

Details for d4iqfb1

PDB Entry: 4iqf, 2.38 Å

PDB Description: Crystal Structure of Methyionyl-tRNA Formyltransferase from Bacillus anthracis

PDB Compounds: (B:) Methionyl-tRNA formyltransferase

SCOPe Domain Sequences for d4iqfb1:

Sequence; same for both SEQRES and ATOM records:

>d4iqfb1 c.65.1.0 (B:-1-204) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
namikvvfmgtpdfsvpvlrrliedgydvigvvtqpdrpvgrkkvltptpvkveaekhgi
pvlqplrirekdeyekvlalepdlivtaafgqivpneileapkygcinvhasllpelrgg
apihyaimegkektgitimymvekldagdiltqveveieerettgslfdklseagahlls
ktvplliqgklepikqneeevtfayn

Timeline for d4iqfb1:

• d4iqfb1 first appeared in SCOPe 2.03
  
• d4iqfb1 appears in SCOPe 2.04
  
• d4iqfb1 appears in SCOPe 2.06
  
• d4iqfb1 appears in the current release, SCOPe 2.08