Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (73 species) not a true protein |
Species Pseudomonas protegens [TaxId:220664] [226563] (1 PDB entry) |
Domain d4ikha2: 4ikh A:104-231 [223237] Other proteins in same PDB: d4ikha1 automated match to d1k0db1 complexed with cl, gsh |
PDB Entry: 4ikh (more details), 2.1 Å
SCOPe Domain Sequences for d4ikha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ikha2 a.45.1.0 (A:104-231) automated matches {Pseudomonas protegens [TaxId: 220664]} llaqesaaryetiqwlmfqmggigpmfgqvgffnkfagreyedkrpleryvneakrllgv ldkhlggrewimgerytiadiatfpwirnligfyeagelvgidnfpevkrvlakfvarpa virgleip
Timeline for d4ikha2: