Lineage for d4ikha2 (4ikh A:104-231)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714173Species Pseudomonas protegens [TaxId:220664] [226563] (1 PDB entry)
  8. 2714174Domain d4ikha2: 4ikh A:104-231 [223237]
    Other proteins in same PDB: d4ikha1
    automated match to d1k0db1
    complexed with cl, gsh

Details for d4ikha2

PDB Entry: 4ikh (more details), 2.1 Å

PDB Description: crystal structure of a glutathione transferase family member from pseudomonas fluorescens pf-5, target efi-900003, with two glutathione bound
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d4ikha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ikha2 a.45.1.0 (A:104-231) automated matches {Pseudomonas protegens [TaxId: 220664]}
llaqesaaryetiqwlmfqmggigpmfgqvgffnkfagreyedkrpleryvneakrllgv
ldkhlggrewimgerytiadiatfpwirnligfyeagelvgidnfpevkrvlakfvarpa
virgleip

SCOPe Domain Coordinates for d4ikha2:

Click to download the PDB-style file with coordinates for d4ikha2.
(The format of our PDB-style files is described here.)

Timeline for d4ikha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ikha1