Lineage for d4ijna1 (4ijn A:3-178)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2137194Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2138437Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2138438Protein automated matches [226839] (52 species)
    not a true protein
  7. 2138845Species Mycobacterium smegmatis [TaxId:246196] [226561] (1 PDB entry)
  8. 2138846Domain d4ijna1: 4ijn A:3-178 [223227]
    Other proteins in same PDB: d4ijna3, d4ijnb3
    automated match to d1g99a1
    complexed with amp, edo, so4

Details for d4ijna1

PDB Entry: 4ijn (more details), 1.7 Å

PDB Description: crystal structure of an acetate kinase from mycobacterium smegmatis bound to amp and sulfate
PDB Compounds: (A:) acetate kinase

SCOPe Domain Sequences for d4ijna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ijna1 c.55.1.0 (A:3-178) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
tvlvvnsgssslkyavvrpasgefladgiieeigsgavpdhdaalraafdelaaaglhle
dldlkavghrmvhggktfykpsvvddeliakarelsplaplhnppaikgievarkllpdl
phiavfdtaffhdlpapastyaidrelaetwhikrygfhgtsheyvsqqaaifldr

SCOPe Domain Coordinates for d4ijna1:

Click to download the PDB-style file with coordinates for d4ijna1.
(The format of our PDB-style files is described here.)

Timeline for d4ijna1: