Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) |
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
Protein automated matches [227071] (5 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226565] (16 PDB entries) |
Domain d4iija2: 4iij A:246-437 [223191] Other proteins in same PDB: d4iija1, d4iijb1, d4iijc1, d4iijd1, d4iije_ automated match to d1z2ba2 complexed with ca, cl, gdp, gtp, mes, mg |
PDB Entry: 4iij (more details), 2.6 Å
SCOPe Domain Sequences for d4iija2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iija2 d.79.2.1 (A:246-437) automated matches {Cow (Bos taurus) [TaxId: 9913]} galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm aalekdyeevgv
Timeline for d4iija2: