Lineage for d4i9nf2 (4i9n F:160-331)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440931Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1440932Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1440933Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1441214Protein automated matches [226882] (7 species)
    not a true protein
  7. 1441302Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225719] (5 PDB entries)
  8. 1441332Domain d4i9nf2: 4i9n F:160-331 [223061]
    Other proteins in same PDB: d4i9na1, d4i9nb1, d4i9nc1, d4i9nd1, d4i9ne1, d4i9nf1, d4i9ng1, d4i9nh1
    automated match to d9ldta2
    complexed with 1e5, 1e6

Details for d4i9nf2

PDB Entry: 4i9n (more details), 2.35 Å

PDB Description: Crystal structure of rabbit LDHA in complex with AP28161 and AP28122
PDB Compounds: (F:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4i9nf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i9nf2 d.162.1.1 (F:160-331) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
sgcnldsarfrylmgerlgvhalschgwilgehgdssvpvwsgmnvagvslktlhpelgt
dadkeqwkqvhkqvvdsayeviklkgyttwaiglsvadlaesimknlrrvhpistmlkgl
ygikedvflsvpcvlgqngisdvvkvtltseeeahlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d4i9nf2:

Click to download the PDB-style file with coordinates for d4i9nf2.
(The format of our PDB-style files is described here.)

Timeline for d4i9nf2: