Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein automated matches [226882] (7 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225719] (5 PDB entries) |
Domain d4i9nb2: 4i9n B:160-331 [223053] Other proteins in same PDB: d4i9na1, d4i9nb1, d4i9nc1, d4i9nd1, d4i9ne1, d4i9nf1, d4i9ng1, d4i9nh1 automated match to d9ldta2 complexed with 1e5, 1e6 |
PDB Entry: 4i9n (more details), 2.35 Å
SCOPe Domain Sequences for d4i9nb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i9nb2 d.162.1.1 (B:160-331) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} sgcnldsarfrylmgerlgvhalschgwilgehgdssvpvwsgmnvagvslktlhpelgt dadkeqwkqvhkqvvdsayeviklkgyttwaiglsvadlaesimknlrrvhpistmlkgl ygikedvflsvpcvlgqngisdvvkvtltseeeahlkksadtlwgiqkelqf
Timeline for d4i9nb2: