SCOP 1.65: Domain d1jcv__: 1jcv -

Lineage for d1jcv__ (1jcv -)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49336] (12 PDB entries)

8. Domain d1jcv__: 1jcv - [22279]
   complexed with cu, zn; mutant

Details for d1jcv__

PDB Entry: 1jcv, 1.55 Å

PDB Description: reduced bridge-broken yeast cu/zn superoxide dismutase low temperature (-180c) structure

SCOP Domain Sequences for d1jcv__:

Sequence; same for both SEQRES and ATOM records:

>d1jcv__ b.1.8.1 (-) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae)}
vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
agqddlgkgdteeslktgnagprpacgvigltn

Timeline for d1jcv__:

• d1jcv__ first appeared (with stable ids) in SCOP 1.55
  
• d1jcv__ appears in SCOP 1.63
  
• d1jcv__ appears in SCOP 1.67
  
• d1jcv__ appears in the current release, SCOPe 2.08, called d1jcva_