SCOPe 2.04: Domain d4hhyd2: 4hhy D:136-343

Lineage for d4hhyd2 (4hhy D:136-343)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225406] (21 PDB entries)

8. Domain d4hhyd2: 4hhy D:136-343 [222609]
   Other proteins in same PDB: d4hhya1, d4hhyb1, d4hhyc1, d4hhyd1
   automated match to d1gs0a2
   complexed with 15r, peg, so4

Details for d4hhyd2

PDB Entry: 4hhy, 2.36 Å

PDB Description: Crystal structure of PARP catalytic domain in complex with novel inhibitors

PDB Compounds: (D:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4hhyd2:

Sequence; same for both SEQRES and ATOM records:

>d4hhyd2 d.166.1.0 (D:136-343) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllk

Timeline for d4hhyd2:

• d4hhyd2 first appeared in SCOPe 2.03
  
• d4hhyd2 appears in SCOPe 2.05
  
• d4hhyd2 appears in the current release, SCOPe 2.08