Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
Protein automated matches [190526] (20 species) not a true protein |
Species Phialidium sp. [TaxId:258839] [226678] (1 PDB entry) |
Domain d4he4a_: 4he4 A: [222545] automated match to d2hpwa_ |
PDB Entry: 4he4 (more details), 2.05 Å
SCOPe Domain Sequences for d4he4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4he4a_ d.22.1.0 (A:) automated matches {Phialidium sp. [TaxId: 258839]} gssgallfhgkipyvvemegnvdghtfsirgkgygdasvgkvdaqficttgdvpvpwstl vttlgygaqcfakygpelkdfykscmpdgyvqertitfegdgnfktraevtfengsvynr vklngqgfkkdghvlgknlefnftphclyiwgdqanhglksafkicheitgskgdfivad htqmntpigggpvhvpeyhhmsyhvklskdvtdhrdnmslketvravdcrktyd
Timeline for d4he4a_: