Lineage for d4h16a_ (4h16 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848474Species Sinorhizobium meliloti [TaxId:266834] [189876] (13 PDB entries)
  8. 2848479Domain d4h16a_: 4h16 A: [222320]
    automated match to d4h15d_
    complexed with cl, mg, p6g

Details for d4h16a_

PDB Entry: 4h16 (more details), 2 Å

PDB Description: Crystal Structure of a short chain alcohol dehydrogenase-related dehydrogenase (target ID NYSGRC-011812) from Sinorhizobium meliloti 1021 in space group P6422
PDB Compounds: (A:) Short chain alcohol dehydrogenase-related dehydrogenase

SCOPe Domain Sequences for d4h16a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h16a_ c.2.1.0 (A:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
ieflnlrgkralitagtkgagaatvslflelgaqvlttararpeglpeelfveadlttke
gcaivaeatrqrlggvdvivhmlggssaagggfsalsdddwynelslnlfaavrldrqlv
pdmvargsgvvvhvtsiqrvlplpesttayaaakaalstyskamskevspkgvrvvrvsp
gwieteasvrlaerlakqagtdleggkkiimdglggiplgrpakpeevanliaflasdra
asitgaeytidggtvpta

SCOPe Domain Coordinates for d4h16a_:

Click to download the PDB-style file with coordinates for d4h16a_.
(The format of our PDB-style files is described here.)

Timeline for d4h16a_: