Lineage for d4gzwc_ (4gzw C:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1802176Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1802177Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 1802178Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins)
  6. 1802440Protein automated matches [193245] (15 species)
    not a true protein
  7. 1802468Species Influenza a virus [TaxId:119210] [193455] (7 PDB entries)
  8. 1802476Domain d4gzwc_: 4gzw C: [222294]
    automated match to d4gzxa_
    complexed with ca, nag, sia; mutant

Details for d4gzwc_

PDB Entry: 4gzw (more details), 2.45 Å

PDB Description: n2 neuraminidase d151g mutant of a/tanzania/205/2010 h3n2 in complex with avian sialic acid receptor
PDB Compounds: (C:) Neuraminidase

SCOPe Domain Sequences for d4gzwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gzwc_ b.68.1.1 (C:) automated matches {Influenza a virus [TaxId: 119210]}
aeyrnwskpqcditgfapfskdnsirlsaggdiwvtrepyvscdpdkcyqfalgqgttln
nvhsnntvrgrtpyrtllmnelgvpfhlgtkqvciawsssschdgkawlhvcitgddkna
tasfiyngrlvdsvvswskeilrtqesecvcingtctvvmtdgsasgkadtkilfieegk
ivhtstlsgsaqhveecscyprypgvrcvcrdnwkgsnrpivdinikdhsivssyvcsgl
vgdtprkndssssshcldpnneegghgvkgwafddgndvwmgrtinetsrlgyetfkvie
gwsnpksklqinrqvivdrgnrsgysgifsvegkscinrcfyvelirgrkeetevlwtsn
sivvfcgtsgtygtgswpdgadlnlmpi

SCOPe Domain Coordinates for d4gzwc_:

Click to download the PDB-style file with coordinates for d4gzwc_.
(The format of our PDB-style files is described here.)

Timeline for d4gzwc_: