Lineage for d4gwka1 (4gwk A:2-177)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831330Species Human (Homo sapiens) [TaxId:9606] [186944] (39 PDB entries)
  8. 1831332Domain d4gwka1: 4gwk A:2-177 [222254]
    Other proteins in same PDB: d4gwka2
    automated match to d2pgda2
    complexed with 3pg, mes

Details for d4gwka1

PDB Entry: 4gwk (more details), 1.53 Å

PDB Description: Crystal structure of 6-phosphogluconate dehydrogenase complexed with 3-phosphoglyceric acid
PDB Compounds: (A:) 6-phosphogluconate dehydrogenase, decarboxylating

SCOPe Domain Sequences for d4gwka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gwka1 c.2.1.0 (A:2-177) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqadialiglavmgqnlilnmndhgfvvcafnrtvskvddflaneakgtkvvgaqslkem
vsklkkprriillvkagqavddfieklvplldtgdiiidggnseyrdttrrcrdlkakgi
lfvgsgvsggeegarygpslmpggnkeawphiktifqgiaakvgtgepccdwvgde

SCOPe Domain Coordinates for d4gwka1:

Click to download the PDB-style file with coordinates for d4gwka1.
(The format of our PDB-style files is described here.)

Timeline for d4gwka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gwka2