Lineage for d4gv4a2 (4gv4 A:322-532)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1681419Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1681420Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1681691Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 1681692Protein automated matches [191197] (6 species)
    not a true protein
  7. 1681724Species Human (Homo sapiens) [TaxId:9606] [225406] (21 PDB entries)
  8. 1681726Domain d4gv4a2: 4gv4 A:322-532 [222195]
    Other proteins in same PDB: d4gv4a1
    automated match to d1gs0a2
    complexed with dms, mej

Details for d4gv4a2

PDB Entry: 4gv4 (more details), 1.8 Å

PDB Description: human artd3 (parp3) - catalytic domain in complex with inhibitor me0328
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 3

SCOPe Domain Sequences for d4gv4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gv4a2 d.166.1.0 (A:322-532) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkcqlqlldsgapeykviqtyleqtgsnhrcptlqhiwkvnqegeedrfqahsklgnrkl
lwhgtnmavvaailtsglrimphsggrvgkgiyfasensksagyvigmkcgahhvgymfl
gevalgrehhintdnpslkspppgfdsviarghtepdptqdteleldgqqvvvpqgqpvp
cpefssstfsqseyliyqesqcrlryllevh

SCOPe Domain Coordinates for d4gv4a2:

Click to download the PDB-style file with coordinates for d4gv4a2.
(The format of our PDB-style files is described here.)

Timeline for d4gv4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gv4a1