Class a: All alpha proteins [46456] (286 folds) |
Fold a.97: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48162] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.97.1: An anticodon-binding domain of class I aminoacyl-tRNA synthetases [48163] (3 families) |
Family a.97.1.0: automated matches [227179] (1 protein) not a true family |
Protein automated matches [226898] (4 species) not a true protein |
Species Borrelia burgdorferi [TaxId:224326] [226462] (1 PDB entry) |
Domain d4grib2: 4gri B:315-490 [222103] Other proteins in same PDB: d4gria1, d4grib1 automated match to d1j09a1 complexed with cl, glu, zn |
PDB Entry: 4gri (more details), 2.6 Å
SCOPe Domain Sequences for d4grib2:
Sequence, based on SEQRES records: (download)
>d4grib2 a.97.1.0 (B:315-490) automated matches {Borrelia burgdorferi [TaxId: 224326]} dyhkldffnsyyirekkdedlfnlllpffqkkgyvskpstleenqklkllipliksrikk lsdalnmtkffyedikswnldeflsrkktakevcsilelikpilegfekrsseendkify dfaesngfklgeillpiriaalgskvspplfdslkligkskvferiklaqeflrin
>d4grib2 a.97.1.0 (B:315-490) automated matches {Borrelia burgdorferi [TaxId: 224326]} dyhkldffnsyyirekkdedlfnlllpffqkkgyvskpstleenqklkllipliksrikk lsdalnmtkffyedikswnldeflsrkktakevcsilelikpilegfekrsseendkify dfaesnlgeillpiriaalgskvspplfdslkligkskvferiklaqeflrin
Timeline for d4grib2: