Lineage for d4gphc_ (4gph C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732618Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. 2732622Protein Heme oxygenase HmuO [89159] (1 species)
  7. 2732623Species Corynebacterium diphtheriae [TaxId:1717] [89160] (16 PDB entries)
    Uniprot P71119
  8. 2732652Domain d4gphc_: 4gph C: [222081]
    automated match to d1iw1a_
    complexed with asc, bla, fe, so4

Details for d4gphc_

PDB Entry: 4gph (more details), 1.7 Å

PDB Description: structure of hmuo, heme oxygenase from corynebacterium diphtheriae, in complex with the putative reaction intermediates between fe3+- biliverdin and biliverdin (data set iv)
PDB Compounds: (C:) Heme oxygenase

SCOPe Domain Sequences for d4gphc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gphc_ a.132.1.1 (C:) Heme oxygenase HmuO {Corynebacterium diphtheriae [TaxId: 1717]}
tataglavelkqstaqahekaehstfmsdllkgrlgvaeftrlqeqawlfytaleqavda
vrasgfaeslldpalnraevlardldklngssewrsritaspavidyvnrleeirdnvdg
palvahhyvrylgdlsggqviarmmqrhygvdpealgfyhfegiaklkvykdeyreklnn
lelsdeqrehllkeatdafvfnhqvfadlgkg

SCOPe Domain Coordinates for d4gphc_:

Click to download the PDB-style file with coordinates for d4gphc_.
(The format of our PDB-style files is described here.)

Timeline for d4gphc_: