Lineage for d1evua3 (1evu A:628-727)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1768856Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) (S)
    automatically mapped to Pfam PF00927
  5. 1768857Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 1768858Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 1768859Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49312] (8 PDB entries)
    Coagulation factor XIII,
  8. 1768869Domain d1evua3: 1evu A:628-727 [22176]
    Other proteins in same PDB: d1evua1, d1evua4, d1evub1, d1evub4
    complexed with ca, pgo

Details for d1evua3

PDB Entry: 1evu (more details), 2.01 Å

PDB Description: human factor xiii with calcium bound in the ion site
PDB Compounds: (A:) coagulation factor xiii

SCOPe Domain Sequences for d1evua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1evua3 b.1.5.1 (A:628-727) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme [TaxId: 9606]}
tipeiiikvrgtqvvgsdmtvtvqftnplketlrnvwvhldgpgvtrpmkkmfreirpns
tvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr

SCOPe Domain Coordinates for d1evua3:

Click to download the PDB-style file with coordinates for d1evua3.
(The format of our PDB-style files is described here.)

Timeline for d1evua3: