![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) ![]() automatically mapped to Pfam PF00927 |
![]() | Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein) |
![]() | Protein Transglutaminase, two C-terminal domains [49311] (4 species) duplication |
![]() | Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49312] (8 PDB entries) Coagulation factor XIII, |
![]() | Domain d1evua2: 1evu A:516-627 [22175] Other proteins in same PDB: d1evua1, d1evua4, d1evub1, d1evub4 complexed with ca, pgo |
PDB Entry: 1evu (more details), 2.01 Å
SCOPe Domain Sequences for d1evua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1evua2 b.1.5.1 (A:516-627) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme [TaxId: 9606]} snvdmdfevenavlgkdfklsitfrnnshnrytitaylsanitfytgvpkaefkketfdv tleplsfkkeavliqageymgqlleqaslhffvtarinetrdvlakqkstvl
Timeline for d1evua2:
![]() Domains from other chains: (mouse over for more information) d1evub1, d1evub2, d1evub3, d1evub4 |