Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (2 families) automatically mapped to Pfam PF00927 |
Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein) |
Protein Transglutaminase, two C-terminal domains [49311] (4 species) duplication |
Species Human (Homo sapiens), blood isozyme [TaxId:9606] [49312] (8 PDB entries) Coagulation factor XIII, |
Domain d1ggtb3: 1ggt B:628-727 [22174] Other proteins in same PDB: d1ggta1, d1ggta4, d1ggtb1, d1ggtb4 |
PDB Entry: 1ggt (more details), 2.65 Å
SCOPe Domain Sequences for d1ggtb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ggtb3 b.1.5.1 (B:628-727) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme [TaxId: 9606]} tipeiiikvrgtqvvgsdmtvtveftnplketlrnvwvhldgpgvtrpmkkmfreirpns tvqweevcrpwvsghrkliasmssdslrhvygeldvqiqr
Timeline for d1ggtb3:
View in 3D Domains from other chains: (mouse over for more information) d1ggta1, d1ggta2, d1ggta3, d1ggta4 |