SCOP 1.65: Domain d1bhgb1: 1bhg B:226-328

Lineage for d1bhgb1 (1bhg B:226-328)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family)

5. Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)

6. Protein beta-Glucuronidase [49307] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49308] (1 PDB entry)

8. Domain d1bhgb1: 1bhg B:226-328 [22162]
   Other proteins in same PDB: d1bhga2, d1bhga3, d1bhgb2, d1bhgb3
   complexed with man, nag

Details for d1bhgb1

PDB Entry: 1bhg, 2.6 Å

PDB Description: human beta-glucuronidase at 2.6 a resolution

SCOP Domain Sequences for d1bhgb1:

Sequence; same for both SEQRES and ATOM records:

>d1bhgb1 b.1.4.1 (B:226-328) beta-Glucuronidase {Human (Homo sapiens)}
tyidditvttsveqdsglvnyqisvkgsnlfklevrlldaenkvvangtgtqgqlkvpgv
slwwpylmherpaylyslevqltaqtslgpvsdfytlpvgirt

Timeline for d1bhgb1:

• d1bhgb1 first appeared (with stable ids) in SCOP 1.55
  
• d1bhgb1 appears in SCOP 1.63
  
• d1bhgb1 appears in SCOP 1.67
  
• d1bhgb1 appears in the current release, SCOPe 2.08