Lineage for d1f4hb1 (1f4h B:220-333)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2036362Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2036363Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 2036364Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)
  7. 2036378Species Escherichia coli [TaxId:562] [49306] (42 PDB entries)
    Uniprot P00722
  8. 2036605Domain d1f4hb1: 1f4h B:220-333 [22155]
    Other proteins in same PDB: d1f4ha3, d1f4ha4, d1f4ha5, d1f4hb3, d1f4hb4, d1f4hb5, d1f4hc3, d1f4hc4, d1f4hc5, d1f4hd3, d1f4hd4, d1f4hd5
    complexed with mg

Details for d1f4hb1

PDB Entry: 1f4h (more details), 2.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (orthorhombic)
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d1f4hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4hb1 b.1.4.1 (B:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

SCOPe Domain Coordinates for d1f4hb1:

Click to download the PDB-style file with coordinates for d1f4hb1.
(The format of our PDB-style files is described here.)

Timeline for d1f4hb1: