Class b: All beta proteins [48724] (177 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) |
Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins) |
Protein automated matches [191200] (7 species) not a true protein |
Species Merkel cell polyomavirus [TaxId:493803] [226460] (4 PDB entries) |
Domain d4fmht_: 4fmh T: [221322] automated match to d1vpsb_ complexed with cl, gol |
PDB Entry: 4fmh (more details), 1.85 Å
SCOPe Domain Sequences for d4fmht_:
Sequence, based on SEQRES records: (download)
>d4fmht_ b.121.6.1 (T:) automated matches {Merkel cell polyomavirus [TaxId: 493803]} vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp aysvarvslpmlneditcdtlqmweaisvktevvgisslinvhywdmkrvhdygagipvs gvnyhmfaiggepldlqglvldyqtqypkttnggpitietvlgrkmtpknqgldpqakak ldkdgnypievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckg dglfiscadivgflfktsgkmalhglpryfnvtlrkrwvk
>d4fmht_ b.121.6.1 (T:) automated matches {Merkel cell polyomavirus [TaxId: 493803]} vevlsvvtgedsitqielylnprmgvnspdlpttsnwytytydlqpkgsspdqpikenlp aysvarvslpmlndtlqmweaisvktevvgisslinvhywdmkrvhdygagipvsgvnyh mfaiggepldlqglvldyqtqypkttgpitietvlgrkmtpknqgldpqakakldkdgny pievwcpdpsknensryygsiqtgsqtptvlqfsntlttvlldengvgplckgdglfisc adivgflfktsgkmalhglpryfnvtlrkrwvk
Timeline for d4fmht_: