SCOPe 2.06: Domain d4flqa2: 4flq A:555-628

Lineage for d4flqa2 (4flq A:555-628)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (34 species)
   not a true protein

7. Species Neisseria polysaccharea [TaxId:489] [226281] (6 PDB entries)

8. Domain d4flqa2: 4flq A:555-628 [221270]
   Other proteins in same PDB: d4flqa1, d4flqa3
   automated match to d1g5aa1
   complexed with gol, pg4, pge, trs; mutant

Details for d4flqa2

PDB Entry: 4flq, 2.5 Å

PDB Description: Crystal structure of Amylosucrase double mutant A289P-F290I from Neisseria polysaccharea.

PDB Compounds: (A:) amylosucrase

SCOPe Domain Sequences for d4flqa2:

Sequence; same for both SEQRES and ATOM records:

>d4flqa2 b.71.1.0 (A:555-628) automated matches {Neisseria polysaccharea [TaxId: 489]}
rlvtfntnnkhiigyirnnallafgnfseypqtvtahtlqampfkahdliggktvslnqd
ltlqpyqvmwleia

Timeline for d4flqa2:

• d4flqa2 first appeared in SCOPe 2.03
  
• d4flqa2 appears in SCOPe 2.05
  
• d4flqa2 appears in SCOPe 2.07
  
• d4flqa2 appears in the current release, SCOPe 2.08