Lineage for d4f7ug_ (4f7u G:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1786638Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1786639Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1787219Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 1787220Protein automated matches [190914] (10 species)
    not a true protein
  7. 1787346Species Mouse (Mus musculus) [TaxId:10090] [226575] (1 PDB entry)
  8. 1787347Domain d4f7ug_: 4f7u G: [221067]
    Other proteins in same PDB: d4f7ua_, d4f7ub_, d4f7uc_, d4f7ud_
    automated match to d3swne_
    complexed with p6g

Details for d4f7ug_

PDB Entry: 4f7u (more details), 1.9 Å

PDB Description: the 6s snrnp assembly intermediate
PDB Compounds: (G:) Small nuclear ribonucleoprotein G

SCOPe Domain Sequences for d4f7ug_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f7ug_ b.38.1.0 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
pelkkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmvvirgns
iimleale

SCOPe Domain Coordinates for d4f7ug_:

Click to download the PDB-style file with coordinates for d4f7ug_.
(The format of our PDB-style files is described here.)

Timeline for d4f7ug_: