Lineage for d4f5ba_ (4f5b A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1918721Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1918722Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1918723Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1918740Protein c-src tyrosine kinase [55556] (3 species)
  7. 1918747Species Human (Homo sapiens) [TaxId:9606] [55557] (46 PDB entries)
  8. 1918754Domain d4f5ba_: 4f5b A: [221037]
    automated match to d4f5aa_
    complexed with ptr; mutant

Details for d4f5ba_

PDB Entry: 4f5b (more details), 1.57 Å

PDB Description: Triple mutant Src SH2 domain bound to phosphotyrosine
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d4f5ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f5ba_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
dsiqaeewyfgkitrreserlllnaenprgtflvresetvkgayalsvsdfdnakglnvk
hylirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpts

SCOPe Domain Coordinates for d4f5ba_:

Click to download the PDB-style file with coordinates for d4f5ba_.
(The format of our PDB-style files is described here.)

Timeline for d4f5ba_: