Lineage for d4f58l1 (4f58 L:1-108)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295971Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
  8. 1296387Domain d4f58l1: 4f58 L:1-108 [221028]
    Other proteins in same PDB: d4f58l2, d4f58m2, d4f58n2, d4f58o2
    automated match to d1q1jl1
    complexed with so4

Details for d4f58l1

PDB Entry: 4f58 (more details), 2.49 Å

PDB Description: Fab structure of a neutralizing antibody L3 from an early subtype A HIV-1 infected patient
PDB Compounds: (L:) Light chain of Fab of a neutralizing antibody L3

SCOPe Domain Sequences for d4f58l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f58l1 b.1.1.0 (L:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsaltqpasvsgspgqsitisctgttsdvgtynfvswyqqhpgkapkaiifdvtnrpsgi
snrfsgskfgntasltisglqaedeadyycaaytvastllfgggtkvtvlrq

SCOPe Domain Coordinates for d4f58l1:

Click to download the PDB-style file with coordinates for d4f58l1.
(The format of our PDB-style files is described here.)

Timeline for d4f58l1: