Lineage for d4f58m2 (4f58 M:109-209)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294263Protein automated matches [190374] (12 species)
    not a true protein
  7. 1294295Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)
  8. 1294579Domain d4f58m2: 4f58 M:109-209 [221031]
    Other proteins in same PDB: d4f58l1, d4f58m1, d4f58n1, d4f58o1
    automated match to d1q1jl2
    complexed with so4

Details for d4f58m2

PDB Entry: 4f58 (more details), 2.49 Å

PDB Description: Fab structure of a neutralizing antibody L3 from an early subtype A HIV-1 infected patient
PDB Compounds: (M:) Light chain of Fab of a neutralizing antibody L3

SCOPe Domain Sequences for d4f58m2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f58m2 b.1.1.2 (M:109-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqs
nnkyaassylsltpeqwkshrsyscqvthegstvektvapt

SCOPe Domain Coordinates for d4f58m2:

Click to download the PDB-style file with coordinates for d4f58m2.
(The format of our PDB-style files is described here.)

Timeline for d4f58m2: