SCOPe 2.06: Domain d4f29a_: 4f29 A:

Lineage for d4f29a_ (4f29 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein automated matches [190140] (30 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (37 PDB entries)

8. Domain d4f29a_: 4f29 A: [220951]
   automated match to d3lswa_
   complexed with qus, zn

Details for d4f29a_

PDB Entry: 4f29, 1.75 Å

PDB Description: quisqualate bound to the ligand binding domain of glua3i

PDB Compounds: (A:) Glutamate receptor 3

SCOPe Domain Sequences for d4f29a_:

Sequence; same for both SEQRES and ATOM records:

>d4f29a_ c.94.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rtivvttilespyvmykknheqlegneryegycvdlayeiakhvrikyklsivgdgkyga
rdpetkiwngmvgelvygradiavapltitlvreevidfskpfmslgisimikkgtpies
aedlakqteiaygtldsgstkeffrrskiavyekmwsymksaepsvftkttadgvarvrk
skgkfafllestmneyieqrkpcdtmkvggnldskgygvatpkgsalgtpvnlavlklse
qgildklknkwwydkgec

Timeline for d4f29a_:

• d4f29a_ first appeared in SCOPe 2.03
  
• d4f29a_ appears in SCOPe 2.05
  
• d4f29a_ appears in SCOPe 2.07
  
• d4f29a_ appears in the current release, SCOPe 2.08