Lineage for d4f0hb_ (4f0h B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957669Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2957670Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2957671Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2957834Protein automated matches [190066] (7 species)
    not a true protein
  7. 2957928Species Red algae (Galdieria sulphuraria) [TaxId:130081] [193382] (3 PDB entries)
  8. 2957929Domain d4f0hb_: 4f0h B: [220929]
    Other proteins in same PDB: d4f0ha1, d4f0ha2
    automated match to d4f0kb_
    complexed with oxy, po4

Details for d4f0hb_

PDB Entry: 4f0h (more details), 1.96 Å

PDB Description: unactivated rubisco with oxygen bound
PDB Compounds: (B:) ribulose bisphosphate carboxylase small chain

SCOPe Domain Sequences for d4f0hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f0hb_ d.73.1.1 (B:) automated matches {Red algae (Galdieria sulphuraria) [TaxId: 130081]}
mritqgtfsflpdltdeqikkqidymiskklaigieytndihprnsfwemwglplfevtd
papvlfeinacrkaksnfyikvvgfssergiestiisfivnrpkhepgfnlirqedksrs
ikysiqayetykpedqry

SCOPe Domain Coordinates for d4f0hb_:

Click to download the PDB-style file with coordinates for d4f0hb_.
(The format of our PDB-style files is described here.)

Timeline for d4f0hb_: