Lineage for d1dp0c2 (1dp0 C:626-730)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 161124Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 161125Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (2 proteins)
  6. 161126Protein beta-Galactosidase, domains 2 and 4 [49305] (1 species)
  7. 161127Species Escherichia coli [TaxId:562] [49306] (23 PDB entries)
  8. 161157Domain d1dp0c2: 1dp0 C:626-730 [22078]
    Other proteins in same PDB: d1dp0a3, d1dp0a4, d1dp0a5, d1dp0b3, d1dp0b4, d1dp0b5, d1dp0c3, d1dp0c4, d1dp0c5, d1dp0d3, d1dp0d4, d1dp0d5

Details for d1dp0c2

PDB Entry: 1dp0 (more details), 1.7 Å

PDB Description: e. coli beta-galactosidase at 1.7 angstrom

SCOP Domain Sequences for d1dp0c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dp0c2 b.1.4.1 (C:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl

SCOP Domain Coordinates for d1dp0c2:

Click to download the PDB-style file with coordinates for d1dp0c2.
(The format of our PDB-style files is described here.)

Timeline for d1dp0c2: