SCOPe 2.07: Domain d4ekdb1: 4ekd B:72-200

Lineage for d4ekdb1 (4ekd B:72-200)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)

6. Protein automated matches [190756] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187954] (3 PDB entries)

8. Domain d4ekdb1: 4ekd B:72-200 [220592]
   Other proteins in same PDB: d4ekdb2
   automated match to d2odeb_
   complexed with alf, cl, co, gdp, mes, mg

Details for d4ekdb1

PDB Entry: 4ekd, 2.71 Å

PDB Description: structure of human regulator of g protein signaling 2 (rgs2) in complex with murine galpha-q(r183c)

PDB Compounds: (B:) Regulator of G-protein signaling 2

SCOPe Domain Sequences for d4ekdb1:

Sequence; same for both SEQRES and ATOM records:

>d4ekdb1 a.91.1.1 (B:72-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pspeeaqlwseafdellaskyglaafraflksefceeniefwlacedfkktkspqklssk
arkiytdfiekeapkeinidfqtktliaqniqeatsgcfttaqkrvyslmennsyprfle
sefyqdlck

Timeline for d4ekdb1:

• d4ekdb1 first appeared in SCOPe 2.03, called d4ekdb_
  
• d4ekdb1 appears in SCOPe 2.06
  
• d4ekdb1 appears in the current release, SCOPe 2.08