PDB entry 4ekd

View 4ekd on RCSB PDB site
Description: Structure of human regulator of G protein signaling 2 (RGS2) in complex with murine Galpha-q(R183C)
Class: signaling protein/inhibitor
Keywords: GTP-binding, Regulator of G protein signaling, homology domain, GTPase activation, SIGNALING PROTEIN-INHIBITOR complex
Deposited on 2012-04-09, released 2013-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-08-28, with a file datestamp of 2013-08-23.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: 0.193
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Guanine nucleotide-binding protein G(q) subunit alpha
    Species: Mus musculus [TaxId:10090]
    Gene: Gnaq
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21279
      • engineered mutation (112-113)
      • engineered mutation (115-117)
      • engineered mutation (170)
  • Chain 'B':
    Compound: Regulator of G-protein signaling 2
    Species: Homo sapiens [TaxId:9606]
    Gene: RGS2, G0S8, GIG31
    Database cross-references and differences (RAF-indexed):
    • Uniprot P41220 (5-End)
      • expression tag (2-4)
    Domains in SCOPe 2.07: d4ekdb1, d4ekdb2
  • Heterogens: GDP, ALF, CO, CL, MG, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ekdB (B:)
    gefgspspeeaqlwseafdellaskyglaafraflksefceeniefwlacedfkktkspq
    klsskarkiytdfiekeapkeinidfqtktliaqniqeatsgcfttaqkrvyslmennsy
    prflesefyqdlckkpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ekdB (B:)
    fgspspeeaqlwseafdellaskyglaafraflksefceeniefwlacedfkktkspqkl
    sskarkiytdfiekeapkeinidfqtktliaqniqeatsgcfttaqkrvyslmennsypr
    flesefyqdlck