PDB entry 4ekd
View 4ekd on RCSB PDB site
Description: Structure of human regulator of G protein signaling 2 (RGS2) in complex with murine Galpha-q(R183C)
Class: signaling protein/inhibitor
Keywords: GTP-binding, Regulator of G protein signaling, homology domain, GTPase activation, SIGNALING PROTEIN-INHIBITOR complex
Deposited on
2012-04-09, released
2013-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated
2013-08-28, with a file datestamp of
2013-08-23.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: 0.193
AEROSPACI score: 0.29
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Guanine nucleotide-binding protein G(q) subunit alpha
Species: Mus musculus [TaxId:10090]
Gene: Gnaq
Database cross-references and differences (RAF-indexed):
- Uniprot P21279
- engineered mutation (112-113)
- engineered mutation (115-117)
- engineered mutation (170)
- Chain 'B':
Compound: Regulator of G-protein signaling 2
Species: Homo sapiens [TaxId:9606]
Gene: RGS2, G0S8, GIG31
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d4ekdb1, d4ekdb2 - Heterogens: GDP, ALF, CO, CL, MG, MES, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence, based on SEQRES records: (download)
>4ekdB (B:)
gefgspspeeaqlwseafdellaskyglaafraflksefceeniefwlacedfkktkspq
klsskarkiytdfiekeapkeinidfqtktliaqniqeatsgcfttaqkrvyslmennsy
prflesefyqdlckkpq
Sequence, based on observed residues (ATOM records): (download)
>4ekdB (B:)
fgspspeeaqlwseafdellaskyglaafraflksefceeniefwlacedfkktkspqkl
sskarkiytdfiekeapkeinidfqtktliaqniqeatsgcfttaqkrvyslmennsypr
flesefyqdlck