Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein automated matches [190032] (11 species) not a true protein |
Species Burkholderia thailandensis [TaxId:271848] [193397] (3 PDB entries) |
Domain d4ek2b_: 4ek2 B: [220589] automated match to d4hr2b_ complexed with cl, da, dms, edo |
PDB Entry: 4ek2 (more details), 2 Å
SCOPe Domain Sequences for d4ek2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ek2b_ d.58.6.1 (B:) automated matches {Burkholderia thailandensis [TaxId: 271848]} alertlsiikpdavaknvigqiysrfenaglkivaarmahlsradaekfyavhaerpffk dlvefmisgpvmiqvlegedailknrdlmgatdpkkaekgtiradfadsidanavhgsda petarveiafffpemnvysr
Timeline for d4ek2b_: