Lineage for d4ek2b_ (4ek2 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1415050Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1415051Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1415295Protein automated matches [190032] (11 species)
    not a true protein
  7. 1415397Species Burkholderia thailandensis [TaxId:271848] [193397] (3 PDB entries)
  8. 1415399Domain d4ek2b_: 4ek2 B: [220589]
    automated match to d4hr2b_
    complexed with cl, da, dms, edo

Details for d4ek2b_

PDB Entry: 4ek2 (more details), 2 Å

PDB Description: The structure of nucleoside diphosphate kinase (NDK) from Burkholderia thailandensis bound to deoxyadenosine monophosphate
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4ek2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ek2b_ d.58.6.1 (B:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
alertlsiikpdavaknvigqiysrfenaglkivaarmahlsradaekfyavhaerpffk
dlvefmisgpvmiqvlegedailknrdlmgatdpkkaekgtiradfadsidanavhgsda
petarveiafffpemnvysr

SCOPe Domain Coordinates for d4ek2b_:

Click to download the PDB-style file with coordinates for d4ek2b_.
(The format of our PDB-style files is described here.)

Timeline for d4ek2b_: