Lineage for d1gcfa_ (1gcf A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2371691Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2371692Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2371913Protein Granulocyte colony-stimulating factor (GC-SF) receptor [49291] (2 species)
  7. 2371917Species Mouse (Mus musculus) [TaxId:10090] [49292] (4 PDB entries)
  8. 2371930Domain d1gcfa_: 1gcf A: [22053]
    2nd domain

Details for d1gcfa_

PDB Entry: 1gcf (more details)

PDB Description: nmr structure of the c-terminal domain of the ligand-binding region of murine granulocyte colony-stimulating factor receptor, 12 structures
PDB Compounds: (A:) granulocyte colony-stimulating factor receptor

SCOPe Domain Sequences for d1gcfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gcfa_ b.1.2.1 (A:) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]}
gssleppmlqaldigpdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvf
hlpsskdqfelcglhqapvytlqmrcirsslpgfwspwspglqlrptmk

SCOPe Domain Coordinates for d1gcfa_:

Click to download the PDB-style file with coordinates for d1gcfa_.
(The format of our PDB-style files is described here.)

Timeline for d1gcfa_: