Lineage for d4eg0b1 (4eg0 B:4-102)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1591384Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 1591385Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 1591668Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 1591669Protein automated matches [226903] (25 species)
    not a true protein
  7. 1591675Species Burkholderia ambifaria [TaxId:398577] [226365] (1 PDB entry)
  8. 1591677Domain d4eg0b1: 4eg0 B:4-102 [220468]
    Other proteins in same PDB: d4eg0a2, d4eg0b2
    automated match to d1e4ea1
    complexed with edo

Details for d4eg0b1

PDB Entry: 4eg0 (more details), 1.65 Å

PDB Description: Crystal Structure of D-alanine--D-alanine ligase from Burkholderia ambifaria
PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d4eg0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eg0b1 c.30.1.0 (B:4-102) automated matches {Burkholderia ambifaria [TaxId: 398577]}
idpkrfgkvavlfggesaerevsltsgrlvlqglrdagidahpfdpaerplsalkdegfv
rafnalhggygengqiqgaldfygirytgsgvlgsalgl

SCOPe Domain Coordinates for d4eg0b1:

Click to download the PDB-style file with coordinates for d4eg0b1.
(The format of our PDB-style files is described here.)

Timeline for d4eg0b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4eg0b2