Lineage for d4eeob_ (4eeo B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2149496Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2149497Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2149506Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins)
  6. 2149564Protein automated matches [190297] (2 species)
    not a true protein
  7. 2149568Species Human (Homo sapiens) [TaxId:9606] [187395] (17 PDB entries)
  8. 2149610Domain d4eeob_: 4eeo B: [220458]
    automated match to d2agda_
    complexed with bbv, gol, mn, nag, so4, udp

Details for d4eeob_

PDB Entry: 4eeo (more details), 2.3 Å

PDB Description: crystal structure of human m340h-beta-1,4-galactosyltransferase-1 (m340h-b4gal-t1) in complex with glcnac-beta1,6-glcnac-alpha-benzyl
PDB Compounds: (B:) Beta-1,4-galactosyltransferase 1

SCOPe Domain Sequences for d4eeob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4eeob_ c.68.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slpacpeespllvgpmliefnmpvdlelvakqnpnvkmggryaprdcvsphkvaiiipfr
nrqehlkywlyylhpvlqrqqldygiyvinqagdtifnrakllnvgfqealkdydytcfv
fsdvdlipmndhnayrcfsqprhisvamdkfgfslpyvqyfggvsalskqqfltingfpn
nywgwggedddifnrlvfrgmsisrpnavvgttrhirhsrdkknepnpqrfdriahtket
mlsdglnsltyqvldvqryplytqitvdigtps

SCOPe Domain Coordinates for d4eeob_:

Click to download the PDB-style file with coordinates for d4eeob_.
(The format of our PDB-style files is described here.)

Timeline for d4eeob_: