Lineage for d4e8hb2 (4e8h B:90-215)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714207Species Silkworm (Bombyx mori) [TaxId:7091] [226184] (9 PDB entries)
  8. 2714217Domain d4e8hb2: 4e8h B:90-215 [220371]
    Other proteins in same PDB: d4e8ha1, d4e8ha3, d4e8hb1, d4e8hb3, d4e8hc1, d4e8hc3, d4e8hd1, d4e8hd3
    automated match to d1r5aa1
    complexed with gsh

Details for d4e8hb2

PDB Entry: 4e8h (more details), 2.12 Å

PDB Description: Structural of Bombyx mori glutathione transferase BmGSTD1 complex with GTT
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d4e8hb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e8hb2 a.45.1.0 (B:90-215) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
knprqraiidqrlnfdlgtlylrylnlytpilfrgeaydqekadkfdealgwlntfldgr
pfvagenmtvaditivvtitnidafgydfssheniakwfertkkmlepygydeidvtgak
mlasfl

SCOPe Domain Coordinates for d4e8hb2:

Click to download the PDB-style file with coordinates for d4e8hb2.
(The format of our PDB-style files is described here.)

Timeline for d4e8hb2: