Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
Superfamily c.116.1: alpha/beta knot [75217] (9 families) known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
Family c.116.1.5: YggJ C-terminal domain-like [89632] (4 proteins) contains extra strand (3) in the parallel beta-sheet, order 321546; similar dimerisation to the MTH1 domain |
Protein automated matches [227088] (1 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [226466] (1 PDB entry) |
Domain d4e8ba2: 4e8b A:74-243 [220359] Other proteins in same PDB: d4e8ba1, d4e8ba3 automated match to d1vhya2 |
PDB Entry: 4e8b (more details), 2.25 Å
SCOPe Domain Sequences for d4e8ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e8ba2 c.116.1.5 (A:74-243) automated matches {Escherichia coli K-12 [TaxId: 83333]} resplhihlgqvmsrgekmeftiqksielgvslitplfsercgvkldserlnkklqqwqk iaiaaceqcgrnrvpeirpamdleawcaeqdeglklnlhprasnsintlplpvervrlli gpegglsadeiamtaryqftdillgprvlrtettaltaitalqvrfgdlg
Timeline for d4e8ba2: