SCOPe 2.07: Domain d4e5oc_: 4e5o C:

Lineage for d4e5oc_ (4e5o C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)

6. Protein automated matches [190469] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225826] (11 PDB entries)

8. Domain d4e5oc_: 4e5o C: [220316]
   automated match to d3ed7a_
   complexed with bu1, ump

Details for d4e5oc_

PDB Entry: 4e5o, 1.7 Å

PDB Description: crystal structure of mouse thymidylate synthase in complex with dump

PDB Compounds: (C:) Thymidylate synthase

SCOPe Domain Sequences for d4e5oc_:

Sequence; same for both SEQRES and ATOM records:

>d4e5oc_ d.117.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rhgelqylrqvehilrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvle
ellwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgaey
kdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvng
elscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplk
iqlqreprpfpklkilrkvetiddfkvedfqiegynphpt

Timeline for d4e5oc_:

• d4e5oc_ first appeared in SCOPe 2.03
  
• d4e5oc_ appears in SCOPe 2.06
  
• d4e5oc_ appears in the current release, SCOPe 2.08