Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) automatically mapped to Pfam PF00303 |
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) |
Protein automated matches [190469] (17 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [225826] (11 PDB entries) |
Domain d4e5oa_: 4e5o A: [220314] automated match to d3ed7a_ complexed with bu1, ump |
PDB Entry: 4e5o (more details), 1.7 Å
SCOPe Domain Sequences for d4e5oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e5oa_ d.117.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rhgelqylrqvehilrcgfkkedrtgtgtlsvfgmqaryslrdefpllttkrvfwkgvle ellwfikgstnakelsskgvriwdangsrdfldslgfsarqegdlgpvygfqwrhfgaey kdmdsdysgqgvdqlqkvidtiktnpddrriimcawnpkdlplmalppchalcqfyvvng elscqlyqrsgdmglgvpfniasyalltymiahitglqpgdfvhtlgdahiylnhieplk iqlqreprpfpklkilrkvetiddfkvedfqiegynphptikmemav
Timeline for d4e5oa_: